SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004771017.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004771017.1.14098
Domain Number 1 Region: 162-226
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004771017.1.14098
Sequence length 689
Comment PREDICTED: nephrocystin-1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MLARRHRHPLQALQRRSQELKLQVDSLLSESRLKGVLDSSKRRDIYQRCVQLKQAIDENK
NALQKLNKADEPAPVGNYNQKKEEEHNLLDKLTHQLQELAVSISRENITEIKTPSEREED
DDSADEDEEAEKEEEDDEEEESEGSGGEEEETEEEEKQENESHSQTSKEYIAVGDFAAQQ
AGDLTFKKGEILLIIEKKPDGWWIAKNAKGNKGLIPRTYVEPYNKEGGQDSSEEGSEEDV
EVEDQTAEGEEVKQRTDSHWSAVRKAISEQINTVDVLTTMGAIPAGFRPSTLFQLLEEGN
QFRASYFLQPELTPSQLAFRDLMWDAKTGTIRSRPSRVSFILTLWSCKMIPLPGMSIQVL
SRHVRLCLFDGNKVLSNIHTVRATWLPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSSP
DLGILFELGISYIRNSTGERGELSCGWVFLKLFDASGIPIPAKTYELFLNGGTPYEKGVE
VDPSISRRAHGSVFHQMMTMRRQPQLLVKLRSLNRRSRDLLSLLPETLIGSMCSIHLLIF
YRQILGDVLLKDRMTMQSADLISNPVLATFPKLLEQPDIMDALRSSWAEKESTLKRSEKR
DREFLKATFLLVYHDCVIPLLHSTLLPPFRWAEEETEAARWKVITDFLKQNQENEGALQA
LLSPDGVHEPFDISEQTYDFLGEIRKNAA
Download sequence
Identical sequences M3YD02
ENSMPUP00000009209 ENSMPUP00000009209 XP_004771017.1.14098 XP_012900465.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]