SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004771158.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004771158.1.14098
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-82
Family Nuclear receptor ligand-binding domain 0.000000000147
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004771158.1.14098
Sequence length 468
Comment PREDICTED: peroxisome proliferator-activated receptor alpha isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MVDTETLICPLSPLEAEDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFSFAEYQYLGSG
PGSDGSVITDTLSPASSPSSVTYPVAAGSADEPSSIALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLAYDRCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDPEDAETADLKSLAKRIYEAYLKNFNMNKVKARVILAGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLKLHLQTNHPDNI
FLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences M3YXR8
ENSMPUP00000016128 XP_004771158.1.14098 ENSMPUP00000016128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]