SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004771467.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004771467.1.14098
Domain Number 1 Region: 174-314
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.92e-17
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004771467.1.14098
Sequence length 371
Comment PREDICTED: caytaxin isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGTTEATLRMENVDVKEEWQDEGLPRPLPEETGMDPLGSPTEDTSPPPNTLNFNGAHRKR
KTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWED
DTPVAAAKNMPGDSADLFGDGAAEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMRVVTH
GGYYGEGLNAIIVFAACFLPDSSSPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATP
RRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVH
SLEDLEQLIPMEHVQIPECVLQYEEERLKARRESARPPPEFVLPRAEEKPEAASAEDRSA
PGTEDQETSLS
Download sequence
Identical sequences M3XZB8
XP_004771466.1.14098 XP_004771467.1.14098 ENSMPUP00000004419 ENSMPUP00000004419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]