SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004772648.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004772648.1.14098
Domain Number 1 Region: 384-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-47
Family Nucleotide and nucleoside kinases 0.00014
Further Details:      
 
Domain Number 2 Region: 181-312
Classification Level Classification E-value
Superfamily SH3-domain 2e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 133-217
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-20
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000306
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004772648.1.14098
Sequence length 585
Comment PREDICTED: MAGUK p55 subfamily member 3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYERQS
PTPVLHSAVALAEDVMEELQAASVHSDERELLQLLSTPHLRAMLMVHDTVAQKNFDPVLP
PLPDNIDEDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVG
DELREVNGITVLHKRPDEISQILAQSQGSITLKIIPATQEEDRLKDSKVFMRALFHYDPR
EDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRR
ATGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGRRERPGSPQEGKGC
AGAESPELLTYEEVTRYQHQPGEPPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHT
TRPRKSHEKEGLEYHFVSKQAFEADLHHSRFLEHGEYKENLYGTSLDAIHAVMAKNKVCL
VDVEPDALQQLRTSEFKPYVIFVKPAIQEKRKTPPMSPACEDTAAPLDEEQQEMAASAAF
IDQHYGHLVDSVLVKEDLQSAHSQLRALLEKLGKDTHWVPISWVR
Download sequence
Identical sequences M3YE02
ENSMPUP00000009559 XP_004772648.1.14098 ENSMPUP00000009559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]