SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004772721.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004772721.1.14098
Domain Number 1 Region: 142-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.77e-39
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 31-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00051
Further Details:      
 
Domain Number 3 Region: 332-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-32
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 4 Region: 966-1019,1081-1215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-31
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 5 Region: 776-958
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-28
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 570-627
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000141
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 541-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004772721.1.14098
Sequence length 1387
Comment PREDICTED: contactin-associated protein 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MCLRLLCILLAAVSGARGWGYYGCDEELVGPLYARSLGASSYYGLFTAPRFARLHGISGW
SPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQQGHNA
TFFGNVNESAIVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKSDVLYFDGDD
AISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGVQGDYVTLELQGAHLLLHMSLGSS
PIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDANLTLDGYVQRFVLNGDFERLNLDNEM
YIGGLVGAAQKNLAYRHNFRGCIENIIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVPH
PVNFGGPHNFVQVPGFPRRGRFAVSFRFRTWDLTGLLLFSRLGDGLGHVELMLSEGQVNV
SIAQTGRKKLQFAAGYRLNDGFWHEVNFAAQENHAVISIDDVEGAEVRVSYPLLIRTGTS
YFFGGCPKPASRSGCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGYYAEVLFDTCGIT
DRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGNFTID
PDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVSA
LANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLDR
SCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCYGD
RNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRVE
LNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRPM
PLQTYIWLEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGHC
AHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAA
REFSHMLSRPVPGYEPGYVPGYDTPGYVPGYHGPGYRLPEYPRPGRPVPGYRGPVYNVTG
EEVSFSFSTDSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTDG
QPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRY
NTPGFSGCLSGVRFNNVAPLKTHFRAPRPMTAELAEALRVQGELSESNCGAMPRLVAEVP
PELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEPK
ATHDYHPGSKPPLPASGTAPVPAPTAASTPAPAPAPTPAPAPAPAPAPAPGPRDQNLPQI
LEESRSE
Download sequence
Identical sequences M3YFH6
ENSMPUP00000010083 XP_004772721.1.14098 ENSMPUP00000010083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]