SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004773567.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004773567.1.14098
Domain Number 1 Region: 277-405,717-890
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.23e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-29
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 3 Region: 1098-1164
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 178-247
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000225
Further Details:      
 
Domain Number 5 Region: 114-173
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004773567.1.14098
Sequence length 1171
Comment PREDICTED: diacylglycerol kinase delta isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEVVTSPAETVIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASV
AESSTKNVNNSFTVITPCRKLILCADNRKEMEEWIAALKTVQNREHFEPTQYSMDHFSGM
HNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGK
DIIEDEDGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLQ
TKCPLGLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFK
QLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGV
LPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYETKLPRQASSSM
GTEDFSEGSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYE
KTTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPTPPPTIAEEVEDGDGAGSG
CGSTGDRSVGSACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEG
FALGLSESEEKKDLKSDDRVCPTESCGVAKGRSLRKVSKSPCEKLISKGSLSLGSSASLP
PQSGNRDGLPALNTKILFSNVRAGMSGSLPGSSVISRLLINADPFNSEPENLEYYTEKCV
MNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLL
ECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQM
AVSRVIKLQHHRIAQCRTVKISILGDEGVPVQVDGEAWIQPPGYIRIIHKNRAQTLTRDR
AFENTLKSWEDKQKCELPRPPSFSLHPEILSEEEATQMDQFGQAAGALIHSIREIAQSHQ
DMERELAHAVNASSKSMDRVYGKPRTTEGLNCGFVLEMVNNIQALCRETALLLAGRVALQ
LDPPQKERLGAALTEMDQQLRKLADTPWLCQSVEPGDEENVMLELSKRSRSGKFRLVTKF
KKEKNSKNREARSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRD
LKDLGVTKVGHMKRILCGIKELSRSTPATEA
Download sequence
Identical sequences M3Y2C9
XP_004773567.1.14098 ENSMPUP00000005480 ENSMPUP00000005480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]