SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004773708.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004773708.1.14098
Domain Number 1 Region: 232-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-48
Family DBL homology domain (DH-domain) 0.0000000891
Further Details:      
 
Domain Number 2 Region: 424-546
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-35
Family Pleckstrin-homology domain (PH domain) 0.00000227
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-25
Family Calponin-homology domain, CH-domain 0.0006
Further Details:      
 
Domain Number 4 Region: 162-232
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004773708.1.14098
Sequence length 775
Comment PREDICTED: rho guanine nucleotide exchange factor 6 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSLEKYCLEP
QTEADCLNNIGDFLKGCATLQVEVFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVVSAPPGPQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKN
YYTVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEICLFQQTLC
QALEECSKFPENQHRVGGCLLNLMPHFKSMYLAYCANHPSAVSVLTQHSDDLEQFMESQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGESIKTLGNVLFMSQVMVQYGTCEEKEERYLLLFSSVLIM
LSASPRMSGFIYQGKIPVAGMVVTRLDEIEGNDNTFEITGNIERIVIHCNSSQDFQEWLE
QLCRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLR
PSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILR
VIEAYCASANLQPGHGSSARKDSLPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYAL
KDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSVLP
Download sequence
Identical sequences M3XS19
ENSMPUP00000001869 XP_004773708.1.14098 ENSMPUP00000001869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]