SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004774006.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004774006.1.14098
Domain Number 1 Region: 91-273
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.85e-75
Family T-box 0.000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004774006.1.14098
Sequence length 436
Comment PREDICTED: T-box transcription factor TBX6 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MYHPRELYPSLGTGYRLGPPQPGTDSSFPPALAEGYRYPDLDPPKLDCFLSGIEAAPCTL
GAAPPLPPLPPALGTEPAPPAPEALHALPGVSLSLENRELWKEFNSVGTEMIITKAGRRM
FPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPA
TGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASFR
FPETAFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPGAAEA
YGSGDAPGGPCDSTLGGDVRESDPEQAPAPREAAPAPAPLCGGSSAEAYLLHPAAFHGAP
SHLPTRNPSFPEAPDSGRPAPYSAAFLELQPGPGGSGYPAAAPPAPFASHFLQGGPFPLA
YPGPGAYLDVGSKPMY
Download sequence
Identical sequences M3YMD5
ENSMPUP00000012492 ENSMPUP00000012492 XP_004774006.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]