SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004774212.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004774212.1.14098
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-37
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 378-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 9 Region: 222-282
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000837
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004774212.1.14098
Sequence length 751
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 7 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTTQGRGTLGLLPNGAVLQKHEGRQTMKQEPGSQTWGQGCSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCQWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHIGEVSAPVQEQKMHLEDMTALGTTEESLPTSSFSESSGSGACLEP
PHDPGIHLLRTGHSAQCASQVPALFQAGKSGDQAAATVLQMVGPQGSAAYQFLSVDYTER
KWKGPALSQRAVFQSIMPENYCSVVSMAGETRMQHSECPAKQEVSKEPGSPGETSGGLCG
IVSEELEAGAACEGTLEKLEGQPSEEEGSRLENDFFKITHEDKDKSTKDGCDEYNELGKH
PDLSSSAVECQGVLKGQKFYQCDECGKAFNRSSHLTGHQRIHTGEKPYECNECGKTFRQT
SQLIVHLRTHTGEKPYECNECGNTYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSQLI
DHQRTHTGEKPYECTECGEAFIRSKSLVRHQVVHTGKKPYRCSECGKAFCSNRNLVDHQR
IHTGEKPYECNECGKAFSRSKCLIRHQSLHTGQKPYKCSDCGKAFNQNSQLVDHERIHTG
EKPFECNECGKAFSLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPY
ECNECGKVFSYSSSLMVHQRTHTGEKPYKCSNCGKAFSDSSQLIVHQRVHTGEKPYECIE
CGKAFSQRSTFNHHQRTHIGEKHSGLAHSVS
Download sequence
Identical sequences M3YN75
ENSMPUP00000012782 XP_004774212.1.14098 XP_012902125.1.14098 XP_012902126.1.14098 ENSMPUP00000012782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]