SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004774732.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004774732.1.14098
Domain Number 1 Region: 377-454
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.02e-22
Family Intermediate filament protein, coiled coil region 0.00042
Further Details:      
 
Domain Number 2 Region: 145-179
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000136
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 185-255
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000204
Family Intermediate filament protein, coiled coil region 0.0071
Further Details:      
 
Weak hits

Sequence:  XP_004774732.1.14098
Domain Number - Region: 287-377
Classification Level Classification E-value
Superfamily Prefoldin 0.00034
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004774732.1.14098
Sequence length 531
Comment PREDICTED: keratin, type II cytoskeletal 4 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MIARQQCVRGRSRGFSCGSAVVGGGKRAAFSSFSVSGGTGRCSSGGFGSRSLYNLGGRKS
IAISMAGSRQGAGFGSAGGFGPGSFGAGFGAGNFGSGFGGSFSGRGGPAFPACPAGGIQE
VTINQSLLTPLHVEIDPEIQKVRTEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNL
LQQQTTTTSSKNLEPLFEAYISALRKQLDTLVNDKGRLQSELKTTQDSVEDFKTKYEDEI
NKRAAAENDFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRVLFAAELSQMQTHVSDTS
VVLSMDNNRDLDLDSIIAEVRAQYEEIAQKSKAEAEALYQTKVQQLQISVDQHGDNLKNT
KSEISELNRLIQRLRAEIENVKKQCQTLQASVADAEQRGELALKDAYSKCTELETALQKA
KEELARMLREYQELLSVKLALDVEIATYRKLLEGEECRMSGERQSAMSISVVSGGASTGG
IGGGLGSCSGFGLGSGFGSGSGSGFGFGGGVCGSSGSKIISTTTMTKRSHR
Download sequence
Identical sequences M3Y5M4
ENSMPUP00000006625 ENSMPUP00000006625 XP_004774732.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]