SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004774755.2.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004774755.2.14098
Domain Number 1 Region: 400-471
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-20
Family Intermediate filament protein, coiled coil region 0.00046
Further Details:      
 
Domain Number 2 Region: 159-194
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000335
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  XP_004774755.2.14098
Domain Number - Region: 198-271
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00183
Family Intermediate filament protein, coiled coil region 0.019
Further Details:      
 
Domain Number - Region: 298-450
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0424
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004774755.2.14098
Sequence length 530
Comment PREDICTED: keratin, type II cytoskeletal 80 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MHGAGGGAGTSHHLTGWSGWEASRPPGANEHCRTGVCSSVPSLPCLRPEPAACHPSKAHS
HTHTHTPVPSRVPGPGAAMACRSCVVGFSSLSSCEVTPAGGPRPGTSGWGICGTPGPGFS
SRSLTGCEAAGTIAKVTVNPSLLVPLDLKVDPAIQQQKNQEKEEMKVLNDKFASLIGKVQ
ALEQRNQLLETRWHFLQGQDSGTFDLGHLYEGYQARLQEELRKVNQERGQLEASLLQVLQ
KVEEFRIRYEEEISKRTDMEFTFVQLKKDLDAECLRRTELETKLKGLQSFVELMKNIYEQ
ELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKLQYDAIAARSLEEAEAYSRRQLEERA
ACSAEFGNSLQSSRSEIADLNVRIQKLRSQILSIKSHCLKLEENIKAAEEQGELAFQDAK
AKLAQLEDALQQAKKDMALQLREYQELMNTKLALDIEIATYRKLVEGEESRMDLPSASMV
SMVQSRSRTAASKPSLSRAPSRKKKNRKGPVIKITEMSEKFLLQESEVSE
Download sequence
Identical sequences M3Y8G8
XP_004774755.2.14098 ENSMPUP00000007625 ENSMPUP00000007625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]