SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004774857.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004774857.1.14098
Domain Number 1 Region: 100-174
Classification Level Classification E-value
Superfamily DEATH domain 0.00000942
Family DEATH domain, DD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004774857.1.14098
Sequence length 193
Comment PREDICTED: ectodysplasin-A receptor-associated adapter protein [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAKEPVEDTDPSTLSFNPSDKYPIQDTGLPKAEECDPITLNCPTESDVQHQGEENSFPDS
TGDPLSDVSKGESCKENCTCPSCSLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNF
ASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRPVGQLMELCRLYHRADVEKVLHRWVDEE
WPKRGRGDHPRNF
Download sequence
Identical sequences M3YMW2
ENSMPUP00000012669 XP_004774857.1.14098 ENSMPUP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]