SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004775595.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004775595.1.14098
Domain Number 1 Region: 288-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-56
Family SPRY domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-20
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004775595.1.14098
Sequence length 472
Comment PREDICTED: tripartite motif-containing protein 60-like [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEFMTALADLQTGASCPICLDYLKEPVTINCGHNFCLSCISMFWKDLNGTFPCPFCRHCS
PERKFTSNPQLSNLIEIAKLLRVRRSKRKRKEEKLICEKHNQVLTFFCQKDLEVLCPQCS
FSTDHRSHYIWPIEKAAPYHRKRLQNCIQPWKERVEQVEKVITMQSRKSLELKKKVQCRR
EEIKSEFEQILLFLKNEQEIVLRQLQDDEMDILTKLNENLTTFSSHLSTLKHLSKEIEGK
STKSELELLTDVKSIYHRYKTLKAPEPFSFQLKEYGYHLAPQYSGLNKIINRFQVDLILD
PETAHRKLIVSEDRKTVQYGNKRHNLPHNPRRFYLSPAILGSRGYNSGRQYWEVKVKDKP
EWIVGVCKDSLPRRKYQKQPILAQDGLWGVGRCSQSNYIALGPKKINLLPKVIPRKIGVF
LDCELCEISFYNLSDRSLLYIFNYYFTETLWPYFYTGTDSKPLKICTVTDSE
Download sequence
Identical sequences M3Z4Z5
ENSMPUP00000018657 ENSMPUP00000018657 XP_004775595.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]