SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004776070.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004776070.1.14098
Domain Number 1 Region: 574-770
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-46
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 509-603
Classification Level Classification E-value
Superfamily Fibronectin type III 9.11e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 295-355
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-16
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 2-39
Classification Level Classification E-value
Superfamily RING/U-box 0.000000012
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  XP_004776070.1.14098
Domain Number - Region: 207-241
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00377
Family TFIIH p44 subunit cysteine-rich domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004776070.1.14098
Sequence length 781
Comment PREDICTED: tripartite motif-containing protein 67 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLHSRGSGLPAG
AAAAPPLDHDAAAGPACGGASGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLK
SPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSSITCPQCHRSASLDHRGLRGFQRN
RLLEAIVQRYQQGRGAVHGASAAAAVAICQLCDRTPPEPAATLCEQCDVLYCAACQLKCH
PSRGPFAKHRLVQPPPPPAPAEAASATPGAAQGAPSGGGGCKSPGGAGAAGGSAARKFPT
CPEHEMENYSMYCVSCRTPVCYLCLEEGRHGKHEVKPLGAMWKQHKAQLSQALNGVSDKA
KEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKM
VWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPK
VSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPSPLLQLEKCCTHNNSVTLAWRMPPFTHS
PVDGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVL
QTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDN
HPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVL
LDLNKHTLTFFINGQQQGPTAFSHVEGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSG
N
Download sequence
Identical sequences M3Y259
ENSMPUP00000005410 ENSMPUP00000005410 XP_004776070.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]