SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004776085.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004776085.1.14098
Domain Number 1 Region: 473-818
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.05e-115
Family Rap/Ran-GAP 0.000000615
Further Details:      
 
Domain Number 2 Region: 946-1022
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000146
Family PDZ domain 0.014
Further Details:      
 
Weak hits

Sequence:  XP_004776085.1.14098
Domain Number - Region: 1650-1698
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0251
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004776085.1.14098
Sequence length 1719
Comment PREDICTED: signal-induced proliferation-associated 1-like protein 2 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSDPRQSQEEKHKLGRASSKFKDPPRIMQSDEYFARKFKAINGNMGPPTSLNASNSAESG
GPANGTPAVPKMGVRARVCEWPPKKDCSKELACKALWESRSQASYESVPSITHNGQNDQS
DGQREEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDVTISDIDAEDVLDQNAVNP
NTGAALHREYGSTSSIDRQGLSGENFFAMLRGYRVDNYDHKAMAPFGFPEFFPCDPAISP
SLHAAAQISRGEFVRISGLDYMDSALLMGRDRDKPFKRRLKSESVETSLFRKLRTVKSEH
ETFKFTCDPEDGRLERGVRPWNCQRCFAHYDVQSILFNINEAMATRANMGKRKNITTGAS
AASQTQMPAGQTGNCESPLGSKEDLNSKENLDADEGDGKSNELVLSCPYFRNETGGEGDR
RIALSRASSSSSSSGEGCSFESSLSSHCTNAGVSVLEVPRESQPVHREKVKRYIIEHIDL
GAYYYRKFFYGKEHQNYFGIDENLGPVAVSIRREKVEDAKEKEGSQFNYRVAFRTSELTT
LRGAILEDAIPSTARHGTARGLPLKEVLEYVIPELSIQCLRQAPNSPKVSEQLLKLDEQG
LSFQHKIGILYCKAGQSTEEEMYNNETAGLAFEEFLDLLGQRVRLKGFSKYRAQLDNKTD
STGTHSLYTTYKDYEVMFHVSTMLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFTPR
SIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLA
KVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKEKVK
PRKDAHLFSVGAIMWHIIARDFGQSADIECLLGISNEFIMLIEKDSKNVVFNCSCRDVIG
WTSGLMSIKVFYERGECILLSSVDNCAEDVREIIQRLGIVTRGCETVEMTLRRNGLGQLG
FHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVVII
QPHDDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPALQPLARASP
VPGTPDRLPCQQLLQQAQAAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPGSSGPWRPQA
AYDGCHSPLLLEHQGAGPLECEGAREREDSLDGSRHLETKWHGPPSKVLSSYKERALQKD
GSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKGAS
TDSGIDTAPCMPAAVLGPVHLAGSRSVIHSRAEQWADSADIPGPDDEPAKMFAVHSYAPA
ISAGSAADGSMGDLSEISSHSSGSHHSGSPSAHCSKNSGSLDTSKVYIVSHSSAQQVPGS
VSKPYHRQGSVSKYVIGWKKSEGSPPPEEPEVAECQGLYGEMDLLSTAAQQTVVGEAASE
TQHVLSKEDFLKLMLPDSPLAEEGRRKFSFYGNLSPRRSLHRTLSDESVCSNRRGSPFGS
SRSSVLDQALPNDILFSTTPPYHSTLPPRTHPAPSMGSLRNEFWFSDGSLSDKSKCADPG
LMPLPDTATGLDWSHLVDAARAFEGLDSDEELGLLCHHSSYLDQRVASFCTLTDMQHGED
LEGAQEPPLCVDPGSGKEFMDTTGERSPSTLTGKVNQLELILRQLQTDLRKEKQDKAVLQ
AEVQHLRQDNRRLQEESQTATAQLRKFTEWFFNTIDKKS
Download sequence
Identical sequences M3Y2K9
ENSMPUP00000005560 XP_004776085.1.14098 ENSMPUP00000005560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]