SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004776244.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004776244.1.14098
Domain Number 1 Region: 79-259
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.14e-53
Family F-box associated region, FBA 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004776244.1.14098
Sequence length 262
Comment PREDICTED: F-box only protein 50 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEEESDRHALGGGMEADEPASPQEPPSPPPPPSPPSPAAPDTPGTPQPEQPTEAYARQLL
LEEWRPPGGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQPLETL
GNFRGWYIRTEKLQHDRSWTVKQQCVDLLAEGLWEELLDDEQPDITVMDWYEDSRLDTCV
YELHVWLLAADRRSVIAQHHVAPRSSGRGPPGCWLQVSHVFRQYGPGVRFVHFLHKTKNQ
REPGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences M3Z220
XP_004776244.1.14098 ENSMPUP00000017632 ENSMPUP00000017632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]