SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004776319.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004776319.1.14098
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000904
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004776319.1.14098
Sequence length 608
Comment PREDICTED: zinc finger protein 527 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAVGLCKAMSQGLVTFRDVALDFSQEEWEWLDPSQKDLYRDVMLENYRNLVWLGLSISKP
NMISLLEQGKEPWMVQKEMSDGQYTDWESWYEIKELSPKWYIGEEEISQGMVKERLRSYD
VEYSSFREAWKYEGEFARHQQKERHFRQVTALKEISAVKMDKKYNNSERSVLLKSVLSPQ
ERVPTVQQVHKFGIYDKMFPPNSVLIERKRLPAEKDSLTDNECEEFNQSTYHSKDTGIRP
AEKPFESSDFSNLLSFHSLFTQHQTTHFGKLPRGFSECDDAFSCYSFFTQPQRIHTGEKP
FVCNDCGKAFSHDFFLSEHQRTHIGEKPYECKECNKAFRQSAHLAQHQKIHTGEKPFACS
ECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCGK
AFSRRIALTLHQRIHTGEKPFKCNECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRT
DSQLNRHHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSYL
NQHQRIHTGEKPYECNECGKAFHQILSLRLHQRIHAGDKPYHCNECGNNFSCASALRRHQ
KIHNRETL
Download sequence
Identical sequences M3Z2D1
ENSMPUP00000017743 XP_004776319.1.14098 ENSMPUP00000017743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]