SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004776374.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004776374.1.14098
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.11e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 219-365
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 121-229
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004776374.1.14098
Sequence length 374
Comment PREDICTED: arf-GAP with dual PH domain-containing protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAKERRRAVLELLQRPGNTRCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSI
RLDAWEEAQVEFMASHGNDAARDKYESKVPPFYYRPTSSDCQLLREQWIRAKYERQEFTH
PDKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGSLKYFNRNDAKEPKAIMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFVYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKESGYTVLDGLPPSTQGHHWPHGITIVTPERRFLLACETEMEQRAWVEAFRKVVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences M3Z2H0
XP_004776374.1.14098 ENSMPUP00000017782 ENSMPUP00000017782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]