SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004778488.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004778488.1.14098
Domain Number 1 Region: 623-1018
Classification Level Classification E-value
Superfamily RNI-like 1.35e-78
Family 28-residue LRR 0.00000533
Further Details:      
 
Domain Number 2 Region: 3-91
Classification Level Classification E-value
Superfamily DEATH domain 1.05e-24
Family Pyrin domain, PYD 0.0042
Further Details:      
 
Domain Number 3 Region: 209-302,333-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000329
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Weak hits

Sequence:  XP_004778488.1.14098
Domain Number - Region: 102-179
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 0.0471
Family USP8 N-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004778488.1.14098
Sequence length 1035
Comment PREDICTED: NACHT, LRR and PYD domains-containing protein 3 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MNMTSVRCKLARYLEDLEDADFKKFKMHLQDYPSQKGCRPLPRSQTEKADHMDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDAPEWDNVHVVCQEESLEEEWMGLLGYLTRI
SICKKRKDYCKKYKKHVRSRFQCIKDRNARLGESVNLNKRYTRLRLVKEHQSQQEREHEL
LAIGRTSARMLDSPVSSLNMELLFEPDDQHSEPVHTVVFQGAAGIGKTILARKIMLDWAS
EKIYQDRFDYLFYIHCREVSLGTRRSLGDLIVSCCPDPNPPICKIVSKPSRILFLMDGFD
ELQGAFDEHTETLCTNWQKVERGDILLSSLIRKRLLPEASLLITTRPVALEKLQHLLDRP
RHVEILGFSEAKRKEYFFKYFSDEQQATEAFRLIQENEVLFTMCFIPLVCWIVCTGLKQQ
MDSGKSLAQTSKTTTAVYVFFLSSLLQSHGENQKHQVSANIRGLCSLAADGIWNQKILFE
ECDLRNHGLQRADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEEQGELR
NLPWRSSKLPNRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQHI
RLELLKWIKEKAKAKNLQIQPSQLELFYCLYEMQEEDFVQKAMGHFPKIEISLSTRMDHV
VSSFCIENCHSMESLSLRLLHNSSKEEEEEEEEEGEMQLSEVDHCVRLDPHAACTHRLVN
CYVTLSLWQGLFSVLSTNSLNLTELNLSDNALGDPGVQVLCEMLQRPGCNIRRLWLGRCC
LSHHCCFNISSVLSSNQKLMELDLSHNTLGDFGIRLLCVGLRHLFCNLKKLWLVSCCLTS
ACCEDLASVLSTNQSLTRLYLGENALGDAGVGILCEKAKHPQCKLQKLGLMNSGLTSGCC
PALSSVLSTNQKLTHLYLRGNSLGDTGVKLLCEGLLHPNCKLQILELDGCSLTSHCCWDL
STLLTSNRSLRELSLGSNDLGDLGVMLLCEVLKQQGCLLKSLKLCEMYFNYDTKCALETL
QEEKPELTIVFEPFW
Download sequence
Identical sequences M3YLI2
ENSMPUP00000012189 ENSMPUP00000012189 XP_004778488.1.14098 XP_012904391.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]