SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004778815.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004778815.1.14098
Domain Number 1 Region: 342-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-60
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 58-144
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 146-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004778815.1.14098
Sequence length 522
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM38 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPQGLILGLRLCAGCLGRSYVLCWAQGLPPPHVPAGHDEPLGCRAAQVSIPYWNLSGKAM
ASATKKMKEEATCAICLSLMSEPVSISCGHSYCNQCIMSFLENQGPVDTSSNTFPCPHCR
APFRLASLRPNKQLGSLIEAIKEMEHEMSCEEHGEHLHLFCEDESQLICWRCERSPRHKG
HHTALIEDVCQDYKEKLQNAVTNLRQLEEECTKLKLFTTKQISEWNEKIDIEKQKIQSDF
KNLQSFLQEEEKSHLWRLEKEKEQTLKRLRDNEATLEQKSQELRSHILELEEKCQSSAQK
LLQDVKDTLRRSWAMTLERPDAHSLELHAVCSVSELYFDVKKMLRSYQVNVTLDPDTAHR
ELILSEDRRQVTRGCPQENLDNSSKRFSILPCILGCEGFISGKHYFEVDVGEGTGWDLGV
CLDSVHRDVGLMQKPQSGFWAIRLCKKKGYLALTCPITSLSLVEQPLVVGIFLDCDVGLV
SFYNMTTGSHIFTFPKASFSDTVRPYFRVYQHSPLFLPPPDE
Download sequence
Identical sequences M3YBF6
XP_004778815.1.14098 ENSMPUP00000008663 ENSMPUP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]