SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004779688.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004779688.1.14098
Domain Number 1 Region: 236-320
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-23
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-21
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 3 Region: 127-217
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 354-459
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004779688.1.14098
Sequence length 521
Comment PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MASTFHPRECELSKQEGQSYGFFLRIEKDTDGHLVRVVEKGSPAEKAGLQDGDRVLRING
VFVDKEEHMQVVDLVRKSGNSVTLLVLDGNSYEKAMKKQVDLKELSQSRKEPSLNDKKLP
SVVNQGAQTWTQPRLCYLVKEGNSYGFSLKTVQGKKGVYMTDITPQGVAMKAGVLAGDHL
IEVNGENVEDASHEEVVAKVKNSGSRVMFLLVDKETDKLHAEQKIKFKRETASLKLLPHQ
PRVVEMKKGSNGYGFYLRAGPEQKGQVIKDIDSGSPAEEAGLKNNDLLVAVNGQSVESLD
HDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSIKEAPAPMPDPT
PPEVSSPDTTEEARDHKPKLCWLVKGENGCGFHLNAIQGQPGSFIKEVQKGGPAELAGLE
DEDIIIEVNGVNVVDEPYEKVVESIQSSGKNVTFLVCGKKAYEYFQAKKIPIVSSMADPL
DAPTDSKEETPAEPEHDSHMAKERAYSTASHSSSNSEDTEM
Download sequence
Identical sequences M3XNH5
XP_004779688.1.14098 XP_004779689.1.14098 ENSMPUP00000000625 ENSMPUP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]