SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004780748.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004780748.1.14098
Domain Number 1 Region: 5-167,194-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.2e-56
Family FCH domain 0.0082
Further Details:      
 
Domain Number 2 Region: 481-673
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 727-787
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004780748.1.14098
Sequence length 928
Comment PREDICTED: rho GTPase-activating protein 4 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MRWQLGEQLRCLELQGELRRELLQELAEFLRRRAEVELEYSRGLDKLAERFSGRGGRLGG
SSREHQSFRKEPSLLSPLHCWAVLLQQTRQQSRESATLGEVLAGPLAQRLSHIAEDVGRL
VKKSKDLEQQLQEELLEVVSELQTAKKTYQLYHTESMNAEAKLREAERQEEKRAGRSATS
APAPATDTGTLRKSSLKKGGRLVEKRQAKFLEHKLKCTKARNEYLLSLASVNAAVSNYYL
HDVMDLMDCCDTGFHVALAQLLRSYVVAESRAQVSHMQGLGSLEEAVEALDPSGDKAKVL
EVHAVAFCPPQRFDYHPHEGDEVAEIRLEMELRDEILPRAQNIQSRLDRQTIETEEVSKT
LKATLQVLLEAVAAEDGDALDSLQASPSTESLKSTSSDAGARQAGRRRGQQQETETFYIT
KLQEYLSGRSVLAKLQAKHEKLQEAIQRGDKDEQDVSWAQYTQRKQQKSRRPRPSSQYNQ
KLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQPRVSEIRDAFERGE
DPLVEGCTPHDLDAVAGVLKLYFRSLDPPLFPPDLFGELLASAELEAVAERVEHVGRLLT
QLPAPTLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVALQGRVNQ
LVQTLIVQPSRVFPPVAVLPGPTYEKCMAPPSSGCLGDAQLEGLAGDNEPELEAGTMAQE
DDLEGVMEAVACFAYTGRTAQELSFQRGDVLRLHERASGDWWRGECAGARGLIPHKYITL
PGSAEKHTVAQGPRAAGEPVSSPEILLAMEFIHRPEPCTPPEAPLGTSGGPSGHRRHCLV
PTSPERYVEVDKAVAQTMDSVFKELLGKTSARQGLGLASTCSPGPGPCSLKPPACSRLGK
NKSLSRGSGVLAPPSASRPQSPDSPLKH
Download sequence
Identical sequences M3YC39
ENSMPUP00000008896 XP_004780748.1.14098 ENSMPUP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]