SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004780926.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004780926.1.14098
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.21e-76
Family BAR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000124
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 5.71e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 818-873
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000446
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004780926.1.14098
Sequence length 874
Comment PREDICTED: rho GTPase-activating protein 42 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKF
SQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFR
KEQIGAAKDGKKKFDKESEKYYSILDKHLNLSAKKKESHLQEADTQIDREHQNFYEASLE
YVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFE
STRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTM
SVSEMKSSGKMNGLVTGSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEA
NRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG
VNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIVA
VKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL
MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLS
TGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSG
GIPWIVSPSPSNGQKNLGLWTTSPESSSKEDAAKTDAESDCQSVASVTSPGDVSPPIDLV
KKGPYGLSGLKRASASSLRSISAAEGSKSYSGSIQSLTSIGSKEIPKAPPNPDLPPKMCR
RLRLDTASSNGYQRPGSVVAAKAQLFENVGSLKLVSSGRQAKAMYSCKAEHSHELSFPQG
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences M3XRQ9
ENSMPUP00000001759 ENSMPUP00000001759 XP_004780926.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]