SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004781522.2.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004781522.2.14098
Domain Number 1 Region: 349-563
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.19e-77
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000322
Further Details:      
 
Domain Number 2 Region: 215-348
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.02e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000394
Further Details:      
 
Domain Number 3 Region: 66-191
Classification Level Classification E-value
Superfamily WGR domain-like 2.62e-43
Family WGR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004781522.2.14098
Sequence length 567
Comment PREDICTED: poly [ADP-ribose] polymerase 2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAARRRGTRSNGVGALDEAGRVHNGNTAVEDPLPAKKTRRCQRQGVKKEPVNGGEANNNK
TEDKQESVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQ
LLEDDAQRHFSVWMRWGRVGKMGQHSLVACSGDLNKAKEIFQKKFLDKTKNNWEDREKFE
KVPGKYDMLEMDYTTNTQSEEESKGDSLKSPLKPESQLDLRVQELIELICNVQAMEETMV
EMKYDTKKAPLGKLTVAQIKAGYRSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLR
TPPLIRTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRKLHCALHPLDHES
YEFKVISQYLQSTHAPTHRDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWV
GILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRVKDTGLLLLSEVALGQCN
ELLEANPEAERLLQGKHSTKGLGKMAPSPASFITLNGSMVPLGPASDTGVLNPDGYTLNY
NEFIVYNPNQVRMRYLLKVRFNFLQLW
Download sequence
Identical sequences M3Z352
ENSMPUP00000018014 XP_004781522.2.14098 ENSMPUP00000018014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]