SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004835795.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004835795.1.39548
Domain Number 1 Region: 581-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-81
Family Eukaryotic proteases 0.000051
Further Details:      
 
Domain Number 2 Region: 87-217
Classification Level Classification E-value
Superfamily SEA domain 2.88e-22
Family SEA domain 0.0071
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000157
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 4 Region: 361-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000379
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 5 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000942
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  XP_004835795.1.39548
Domain Number - Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000393
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004835795.1.39548
Sequence length 829
Comment PREDICTED: transmembrane protease serine 7 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MDKENSDASSEPADLIISNISIQVVSVPGRLPRRGPPRKPIGKARPNKQSKNRAPFWNVQ
NKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFVGMFRITNIEFLPEYRQKESREFL
SVARTVQQVVNLVYTTSAFSKFYKQSVVEDVSSNNKGGLLVHFWIVFVMPHAKGHIFCED
CVAAILKDSIQTSIINRTSVGSLQGLAVDLDSVVLNAGLRSDYSSTIGSDKGCSQYFYAD
QLSLHYPLEISATSGRLMCHFKLVAIVGYLIRLSIESIQLEADNCVTDSLTIYDALLPIR
STVLYRLCEPTRTLMSFVSTNNLMLVTLKSPYIRRLSGIRAYFEVIPEQKCENTVLVKEI
PGFEGKISSPYYPSYYPPKCKCTWKFQTPLSTLGIALKFHNYSITKKSAKGCEHGWWEIN
EHLYCGSYMDHQTIFRVPSSLVYIQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSG
LCIPQTQRCDGVNDCFDESDELFCVPIKPACDVTPFRQPGPLVCDGFQDCENGQDEHNCT
QSIPCTNRTFKCDNDVCFKKQNARCDGIVDCPNGSDEDSCSCSRTSSSLNRIVGGADSQE
GAWPWQVSLHFFGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQNFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADNKGSPILQQAEVELIDQTLCVSTYGIITSRMLCAGVISGKRDACKGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences G5B1E1
XP_004835795.1.39548 HGL_H00000389163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]