SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004835984.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004835984.1.39548
Domain Number 1 Region: 53-180,211-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 
Domain Number 2 Region: 618-692
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 309-403
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000196
Family D-aminoacid oxidase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004835984.1.39548
Sequence length 726
Comment PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAFHKVVKGTVLVGGGALATVLGLSQFAHYRRKQVNLAYVEAAECFEPVNREPPSREAQL
LTLRNTLEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVRY
LQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLYD
LVAGSNCLKSSYVLSKSRALEHFPMLQKDRLVGAIVYYDGQHNDARMNLAVALTAARYGA
ATANYMEVVSLLKKTDPETGREHVSGARCKDVLTGQEFDVRAKCVINATGPFTDAVRKMD
DKSAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDSPTDI
THHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHV
VDISESGLITIAGGKWTTYRSMAEDTVNAAIKVHNLKAGPSRTVGLFLQGGKDWSPTLYI
RLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGI
KEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDEKKKEKELETARRFLYY
EMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMDE
NTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVD
RSCGGL
Download sequence
Identical sequences G5BQN8
HGL_H00000308610-2 XP_004835983.1.39548 XP_004835984.1.39548 XP_004835985.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]