SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004842395.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004842395.1.39548
Domain Number - Region: 70-88
Classification Level Classification E-value
Superfamily SH3-domain 0.022
Family SH3-domain 0.0057
Further Details:      
 
Domain Number - Region: 35-96
Classification Level Classification E-value
Superfamily Subunit III of photosystem I reaction centre, PsaF 0.0327
Family Subunit III of photosystem I reaction centre, PsaF 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004842395.1.39548
Sequence length 251
Comment PREDICTED: uncharacterized protein C21orf140 homolog [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MPHSATPLLKNIIIRSQFDSIRRKQCLQYLKTLKSLRYDGFQTVYLGETDIPESLVTGED
FGNGYFLPTPTWCMVHAGGSQGWVPWNYQMFLRDELCTKQEDKLFFEFCDVVKKAYGKCA
IVVKGRRQENETKPKEDGEAEVQFYVPPVINLSSIVCCPEVAKFYGHELLSLPSPYNYLN
PLDSAWSSLKWFIINNRKGFCLQSTDNVYSYQYILFSDLISKGIERINLSKWKTIVKKVQ
RWENYYLGKFS
Download sequence
Identical sequences G5AM20
HGL_M00000049694 XP_004842395.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]