SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004845158.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004845158.1.39548
Domain Number 1 Region: 53-314,413-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000324
Further Details:      
 
Domain Number 2 Region: 504-665
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.27e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 291-409
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.09e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004845158.1.39548
Sequence length 665
Comment PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAGVGTVSRFLRARRLALSRAQWPAAFRAQACGFHFSVNGNKRASAKVSNSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRLRAKNTVVATGGYGRTYFSCTSAHTTTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDIVCRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRG
QVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESSRPGD
KVPPVKPNAGEESVTNLDKLRFADGSIRTSELRLNMQKTMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLLLCALQTIYGAEARKESRGAHAREDYKV
RIDEFDYSKPIQGQQKRPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCSTVPP
AIRSY
Download sequence
Identical sequences G5BPG8
XP_004845158.1.39548 HGL_H00000264932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]