SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004849535.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004849535.1.39548
Domain Number 1 Region: 668-815
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.1e-37
Family Toll/Interleukin receptor TIR domain 0.0000431
Further Details:      
 
Domain Number 2 Region: 370-634
Classification Level Classification E-value
Superfamily L domain-like 5.1e-37
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 3 Region: 25-294
Classification Level Classification E-value
Superfamily L domain-like 9.45e-34
Family Ngr ectodomain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004849535.1.39548
Sequence length 837
Comment PREDICTED: LOW QUALITY PROTEIN: toll-like receptor 4 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MTPSQVLAGTLLPAMAFLACVRPESWEPCVEVVPNITYDCMEQNLYKIPSSIPSSAKHLD
LSFNPLMFLGSQSFTSFPELEVLDLSRCEIQKIEDDAYWGLHYLSTLILTGNPIKNLAPG
AFSGLLSLQKLVAVEINLSSLENFPIGHLKTLKELNVAHNLVRSFKLPEYFSHLNNLEYL
DLSNNKIQNIYHKDLHVLYNNSKLSLDLSLNPIDFIQPGAFDKMRLQGLTLRSNFDNTSV
MKTCIQGLAGLEVNQLVLGEFKNERYVEEFDKSALQGLCTLTIEEFRLSYLDDFPKNING
LFNCLVNVSAVSLAHVYSRRLEGLPKDLKWQSLELVKCKVNQFPAFSIPSLKRYSFTANR
GVNSFTDLTLKNLEFLDLSGNGMSFKGCCSVKDLETPNLKYLNLSFNDVISMSSNFMGLE
LLERLEFQHSTLKQTSQFSMFLSLSRLLYLDISYTHTHVAFHGIFSGLFSLQVLKMPGNS
FKDNTLSNIFMEVTNLTLLDISECQLEHVSQGVFDKLLRLRVLNMSNNHFLLLDALSFKP
LHTLQNLDCSSNRIASSNGQDLQHFPSNLTTLNLTQNPFDCSCEHQSFLQWIKDQRHLLV
EAERLECAMPPDMQGKMLLSFRNATCQIPKVIIIVTVVSVLVVSVIACLVYKFYFHLMLL
AGCKKYGQGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFKLCLHYRDFIPGVAIAAN
IIQEGFHKSRKVIVVVSQHFIESRWCIFEYEIAQTWQFLSSRAGIIFIVLQKLEKSLLRQ
QVELYRLLSRNTYLEWEDHGLGRHIFWRRLRKALMDGKSWNPEEQQMQKTARKKQPL
Download sequence
Identical sequences XP_004849535.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]