SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004854031.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004854031.1.39548
Domain Number 1 Region: 307-596
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.65e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000237
Further Details:      
 
Domain Number 2 Region: 129-306
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-41
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00041
Further Details:      
 
Domain Number 3 Region: 598-704
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.27e-25
Family Anticodon-binding domain of Class II aaRS 0.00095
Further Details:      
 
Domain Number 4 Region: 68-129
Classification Level Classification E-value
Superfamily TGS-like 0.000000000085
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004854031.1.39548
Sequence length 715
Comment PREDICTED: threonine--tRNA ligase, mitochondrial isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MQLYQRWRPLLLVLRLPGLQAYKLRTLHEASMPTPPHWLVERLGLFEKLWAVQVTRLAST
ARKEARTIKVSLPGGQKVDAVAWNTTPYQLARQMSSTLADTALAAEVNGESYDLERPLET
DSDLRFLTFDSPEGKSVLWHSSAHILGAAAEQFLGAVLCRGPSTDRGFYHDFFLGKERTV
QGSQLPILEQICQRMAADAQPFRRLEVSQDQLRQLFKDNPFKLRVIEEKVTGPTATVYGC
GTLVDLCRGPHLRHAGQIGGLKLLATSSVWRSPGSLEPLQRVLGISFPTPELLRAWEAQR
EEAESRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTP
TVFSVKLWKQSGHWGHYRENIFALQPKGSDPARHPTETLALKPMNCPAHCLMFAHRPRSW
RELPVRLADFGALHRAEASGGLGGLTRLWRFQQDDAHIFCAPEQLQAEIRGCLDFLCSVY
AVLGFSFSLSLSTRPSSFLGEPRLWDHAEQVLQQALEESGEPWALKPGDGAFYGPKIDVH
LQDALGRPHQCGTIQLDFQLPMRFNLQYKGQAGALERPVLIHRAVLGSVERLLAVLTESC
GGKWPLWLSPFQVAVIPVGTEQEEYAREIQQSLQAAGLASDLDTDPGLTLSRKVRRAQLT
HYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLTAAVQRLLELQNARVSNAEEVF
Download sequence
Identical sequences G5BH39
XP_004854031.1.39548 HGL_H00000358060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]