SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004866407.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004866407.1.39548
Domain Number 1 Region: 383-571
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.74e-58
Family DNA polymerase beta-like 0.0000000401
Further Details:      
 
Domain Number 2 Region: 233-325
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 9.55e-27
Family DNA polymerase beta, N-terminal domain-like 0.0000106
Further Details:      
 
Domain Number 3 Region: 327-381
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.46e-17
Family DNA polymerase beta-like, second domain 0.00011
Further Details:      
 
Domain Number 4 Region: 40-132
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000189
Family BRCT domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004866407.1.39548
Sequence length 572
Comment PREDICTED: DNA polymerase lambda isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MDPRGILKAFPKRKKINANLPSNAPAKIPKRQEGEESGEWLSSLRVHVVPTGIGRTRAEL
FEKQIIQHGGQICPAQAPGVTHIVVDEAMDCERALRLLRLPWLPPGTQLVKSAWLSLCLQ
ERRLVDTASFSILIPNRNLDQPQPTKAEQDSSAPPGSHEVLLKTAFSSLSGAVSPPQKAE
EASSTQAQPSSNDETSDVEGPQVSAADLEALISGNYPTPPEENSGPGPAPEALDKWVCAQ
PSSQKVTNHNLHITEKLEVLVNAYSVQGDKWRALGYTKAISALKSFHKPVSSYQEACSIP
GVGKRMAEKIMEILESGHLRKLDHISESVPILELFSNIWGAGTKTAQMWYHQGFRSLEDI
RNQASLTDQQAIGLKHYSDFLERMPREEAAEIEQTVRVAAQALSPGLWCVACGSYRRGKL
TCGDVDVLVTHPDGRSHRGIFSRLLDKLRQQGFLTDDLLSQEDHCQQQKYLGVCQLPGPG
RRHRRLDIIVVPYSQFACALLYFTGSAHFNRSMRALAKTKSMSLSEHALCTAVVRDTQGS
KLGPGHVLPTPTEKDVFWLLGLPYREPAERDW
Download sequence
Identical sequences G5CAF7
HGL_H00000299206 XP_004866404.1.39548 XP_004866405.1.39548 XP_004866406.1.39548 XP_004866407.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]