SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004872564.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004872564.1.39548
Domain Number 1 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 456-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 206-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 331-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-20
Family KRAB domain (Kruppel-associated box) 0.00059
Further Details:      
 
Domain Number 7 Region: 497-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 163-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 9 Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000012
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 95-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000183
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 539-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000618
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 250-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000053
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004872564.1.39548
Sequence length 583
Comment PREDICTED: zinc finger protein 791 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MDSVAFEDVSVDFTQEEWALLDPLQKKLYRDVMWETFRNLAYIGSKWEDQQIKDQYKKQG
RNLRSYLIQRLCESKEDGQYGETLSRISDPTRTKKTTGVKPYKCSVCGKGFMLHSSLTRH
IKSHPGHELDGFRYGEKPYKCKECGNTFSYLKSFQRHERNHTGENPYKCKQCGKTFIYHQ
PFQTHELMHIGEKPYQCKHCGKALSSPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIQI
HERTHTGEKPYTCKECGKAFISRTSVQTHMITHNGNRPYKCKECGKAFIRPSFLRVHERI
HTGEKPYKCKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKAFSARPAFRVHTRVHTGE
KPYKCKECGKAFSRLSYCRVHERTHTGEKPYGCKKCRKTFNYPLDLQIHERNHTGEKPYE
CKECAKAFISLENFRRHMITHTGDGPYKCRECGKPFIFLSALRTHERTHTGEKPYACKQC
GKAFSCSSYVQIHERTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKQCGRAF
SLRSSFQRHERTHSSQKHFECKQCGKGFTLFSSLNRHVRLHSR
Download sequence
Identical sequences XP_004872564.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]