SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004872897.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004872897.1.39548
Domain Number 1 Region: 418-522
Classification Level Classification E-value
Superfamily occludin/ELL-like 2.62e-33
Family Occludin/ELL domain 0.00000157
Further Details:      
 
Weak hits

Sequence:  XP_004872897.1.39548
Domain Number - Region: 58-271
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00418
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 
Domain Number - Region: 275-355
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0403
Family ADP-ribosylating toxins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004872897.1.39548
Sequence length 524
Comment PREDICTED: occludin isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MSSRPFESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLLGGGIGYPYGGSGFSGYGSGYGY
GYGYGYGYGAGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSELSRTRRYYLTVIILS
AILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYALCNQFYAPAVSGLYMDQYLYHYCVV
DPQEAIAIVLGFLIVVAFALIIFFAVRTRGKMDRYDKSNILWDKERIYDEQPPNVEEWVK
NVSAGTQDMPPPPSDYVERVDSSMAYSSNGKVNGKQPYPEPSYKSTPLVPEVAQELPLTS
PVDDFRQPRYSSTSNFETPSKRAPTKGKAGKLKKAEQDHYETDYTTGGESCDELEEDWIR
EYPPITSDQQRQLYKRNFDSGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMTAA
DEYNRLKEVKRSADYRNKRNYCKQLKSKLSHIKKMVGDYDRQKT
Download sequence
Identical sequences G5C0I2
HGL_H00000379719 XP_004872894.1.39548 XP_004872895.1.39548 XP_004872896.1.39548 XP_004872897.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]