SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004873144.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004873144.1.39548
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.68e-64
Family N-terminal domain of xrcc1 0.000000124
Further Details:      
 
Domain Number 2 Region: 533-623
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-22
Family DNA-repair protein XRCC1 0.00000726
Further Details:      
 
Domain Number 3 Region: 314-398
Classification Level Classification E-value
Superfamily BRCT domain 4.97e-22
Family BRCT domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004873144.1.39548
Sequence length 627
Comment PREDICTED: DNA repair protein XRCC1 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKSISVVLQLEKEEQIHSVDI
GNNGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRIFGPDKLVRTA
AEKHWDRIKIVCSQPYSKDSPYGLSFIRLHSPPDKEEAEVPSQKVTVTKLGQFRVKEEDE
SASSLRPGALFFGRINKTSPAKASDPAGPSYAAATLQASTSPLSKAVGSTTKPQESTKGK
RKLDLNVEERKIPSKPSAQLSPPALKRPKLPAPTRNPAAAPVPATAQRAVPRKPRGEGTE
PRGAQAGPQELGKILQGVVVVLSGFQNPFRSDLRDKALELGAKYRPDWTPDSTHLICAFA
NTPKYSQVLGLGGRIVRKEWVLDCYRMRRRLPSRRYLMAGPDSSSEDEVASPSGSSGDEA
PSLPRKCPQTKVKPPLAAGSSSPQKPPSPKEIKAASVGPQENSDTEEQSAGRDNGAEESG
DTEDELRRVAEQREHRLPPGQEENGEDPYAGSTDENTDNEGHPELPEEPIPELPDFFQGK
HFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDSSFEEALMDNPSLAF
VRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences G5AZN8
HGL_H00000262887 XP_004873144.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]