SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004873971.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004873971.1.39548
Domain Number 1 Region: 75-177
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-35
Family Chaperone J-domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 325-413
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.88e-24
Family HSP40/DnaJ peptide-binding domain 0.0003
Further Details:      
 
Domain Number 3 Region: 236-333
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 8.63e-16
Family HSP40/DnaJ peptide-binding domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004873971.1.39548
Sequence length 420
Comment PREDICTED: dnaJ homolog subfamily B member 5 isoform X2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MFKRTVLSCPPPTAPPLQARGAFRSFPHFWGEDFLASLMFKIQLEPLKLRAWTLNGFVKF
RNKETSTGPVAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEI
AEAYDVLSDPKKRSLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPF
DIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQD
PPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFP
KEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVI
PLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
Download sequence
Identical sequences G5BXB7
XP_004873970.1.39548 XP_004873971.1.39548 XP_010617581.1.5607 HGL_H00000413684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]