SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004875006.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004875006.1.39548
Domain Number 1 Region: 120-545
Classification Level Classification E-value
Superfamily Sema domain 1.7e-101
Family Sema domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1444-1572,1769-1949
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.79e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 1004-1093
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000191
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 912-1007
Classification Level Classification E-value
Superfamily E set domains 0.000000000000165
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 5 Region: 548-599
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000327
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1092-1136,1170-1223
Classification Level Classification E-value
Superfamily E set domains 0.000000224
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004875006.1.39548
Sequence length 1988
Comment PREDICTED: plexin-B3 isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MAGPEEAGTPTRASGPGPEPWDFRLVAPGCPLRVAWEPAAGRHPLPHTDNALHSPLVPVT
TAQGSQAEAKRHTAWETTLLQPSAPAPVMAPWPPFGFHLLLPPLLLLCPLPSLPCSGSHH
FSAPNTTFNHLALAPGRGTLYVGAVNRLFQLSPELQLEVMAATGPIVDSPDCVPFRDLAE
CPQARLTDNANQLLLVSSRAQELVACGQVRQGVCEKRHLEDVATVLYQAEDPGDGQFVAA
NTPGVATVGLVVPLPDRDLLLVARGLAGKLSAGVPPLSVRQLAGPQPFSSEGLGRLVVGD
FSDYNNSYVAAFANAHFAYFVFRRRGSRAQAEYRSYVARVCLGDANLYSYVEVPLACQGQ
GLIQAAFLTPGSLLGVFAAGLSGAHEALCTFPLAELDSSMERARRLCYTAGGRGPSGTEE
ATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRRALEAQPLLRVRQPMSAVAALQVD
GHTIAFLGDTQGQLHKVFVNSSQGQVYHSQQVGPPGAAISPDLLVDSSGSHLYVLTAQQV
TRVPVAACPQFPDCPSCLQARDPLCGWCILQGRCTQKGRCPRAAQPRQWLWSYKEDSRCL
RVQSLQPAQQPRQEQGQVTLSVLWLPTLAEDEYFHCAFGDYDSLAHVQGPHVACVTPPED
QVPRNPPGTDHVTLHLALMFEDVAVATTNFSFYDCSTVQALEVAAPCHTCVSSPWRCHWC
PQSSRCVHGEHCPEGERTVYSTQEEAIQARGPGACPQVEGLAGPHLVPVGWDIGLALHVR
NLQYFRGLPASYNCWLELPGELRRLPASLQETAGDRDRDGGTGLIHCRAQQFHPSTSQWE
LPVPIYVTRGETQRLDNALTLHVTLYDCTVGHPDCSHCQAANGSLGCLWCGDSQPGCRYE
RLCPPGAVQLLCPKPSIEAIEPLTGPTEGGLALTILGSDLGRTFADVRDAVSVAGRPCSP
DPSHYHTSARIVCVTSPAPSGTTGPVQVAIKNRPPGVSAQHFTYQDPILLSLSPQWGPQA
GGTRLTIHGQHLQTGGNISAFVGGQACPILEPMCPEAIVCRTMPQAMPGEAAVLVVFGHA
ERKLLTSPFRYTANPRLLAAEPNVSFRGGGRLIRVRGTSLDAVWQPLLSVWLEAEVEVKA
LGDSNPRRTCGAPAADPQSCVRLAGGLLQCSTICSVNSSSLLLCRSPAVPDGAHPKRVFF
ALDNVHVDFASASGGQGFQYQPNPHLAPLSREGPSRPYRLKPGHVLDVEGKGLNLGISKE
EVRVHIGDGECLVKTLTLTHLYCEPPPRAPQAANGSSALPQFVVQMGNVRLALGPVQYEA
EPTLPAFPVEAQVGLGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLENLETGVGD
QCRKEFTDLMTEMTDLSSDLEASGIPFLDYRTYAERAFFPGHGGCPPQPKLQGPGEEGHR
ATVCQALTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIM
KTLLGDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYTFLREVAGEPLYMLFRAIQY
QVDKGPVDAVTGKAKRTLNDSHLLREDVEFRPLTLMVLVGPGAGGAAGGAEVQRVPARVL
DTDTITQVKEKVLDQVYKGTPFSQRPSVYTLDLEWRSGLAGHLTLSDEDLTSVTQNHWKR
LNTLQHYKVPDGATVGLIPQLHSGGAVSRSLAQSCPSGENVPMLEEGEEGGMRLWHLVKA
TEEPEGTKVRRSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSMNRPV
PLAVKYLFDFLDELAEKHDIEDPETLHIWKTNSLLLRFWVKALKNPQLIFDVHVSDNVDA
ILAVIAQTFIDACTISEHKVGRDSPVNKLLYAREIPRYKQMVEKYYSDIRHSSPASYQEM
NSALAELSGNYTSAPHCLEALQELYNHIHKYYDQIISALEEDPLGQKMQLACRLQQIVAL
VENKVTDL
Download sequence
Identical sequences XP_004875006.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]