SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004915612.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004915612.1.99540
Domain Number 1 Region: 37-500
Classification Level Classification E-value
Superfamily Sema domain 5.62e-120
Family Sema domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 1057-1323
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-78
Family Protein kinases, catalytic subunit 0.00000000461
Further Details:      
 
Domain Number 3 Region: 656-746
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000486
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 744-836
Classification Level Classification E-value
Superfamily E set domains 0.0000000000168
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 5 Region: 501-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000112
Family Plexin repeat 0.00097
Further Details:      
 
Domain Number 6 Region: 544-618
Classification Level Classification E-value
Superfamily E set domains 0.0000000571
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004915612.1.99540
Sequence length 1368
Comment PREDICTED: macrophage-stimulating protein receptor isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MGTLCTALLSLLLLPTITTSQCPSLPPSLTLDTKVRYQFPNFTASRPIQNLVSFEDSLFL
TTTNHLYVLKGNELHLLQNITTGPTDSQCTLCSKCQLGEALPKQPEDTVSQVLAVDPEES
VIYSCGSSLHGLCYMHIIASSKIVESECLFRQSGNSASSCPDCIASPLGTLLSVVTQSRG
VYFYTASSLDSRIAESYSPTSISIRRLLGSQDGFSPGFHSLSVLESYRDSYPIHYVHTFV
SGSYVYFLTVQPEHPLSNTYHSRVVRLSKNEEEMRSYRELILECRLEPKRRRRRRRAEPK
IFNVLKAAHVATVGSTLAGELDISEKDPVLFAVFAQSEPKSAQPRYNSAVCAFPLRLIDL
SIEDGMNACCSNTNSVRLTRGLNFFQPEMDCPQKDNQSDTSCKNVPTLVLPPLRRVDIFN
GQLDGVLLTSVYVSPQEDLTIGFLGTSAGRLLQVVLQRNSNPRTLSNFSISDNYPVSREV
TQIGDSLFFVTGNQVTKVNITGPGCRHFLTCSRCLRAPRFMGCSWCKNVCCQQGECEGEC
AQNTCLPAITDFYPKTAPLRGNTNITLCGRDFQSSVVYNAPPKAKITAGTHRVSVGPRTC
IVNPGKSNSTSLVCTLQTEGPPDTASTADIALTIDENLTGTPYYIKGTISAAGFNFVEPA
ITSIEPNFGPLAGGTMLTLKGQNLRSGETQRVFISGAECMISGSLCPAEVLCCVSPRSLS
LGPLNVSALLDGAEISSPAQFQYKPDPLVSVIRPNCSLASGTRLTIQGSNLDSVSSIKIS
YSGQKTVSSDCQGTFSSDRIVCRTPEYPYFGRPGNLTLALDAVNYIYPYRFRYLQNYVIH
PFRPKDPDGGILKLKKGEDEIETHQENLEQVATCLKVSMTVGGRECNPTVLKNEITCRIP
KGMVIPSEGSIVQVCVDDDCTTVGLVMIVNMLDPVLGIVLGSVASVLVVAVLIFLLLKHQ
RKKKKKPAVEALELLSNNNREPVLSPISLLHVDYRTSYIPSSNSGGMLSHGAGYSGGSLG
GGSMPILLTSLLDSLRPELLEEVKDVLIPERCLTTHRDRIIGKGHFGSVYHGTYVDEDQQ
EVHCAVKSLNRITDLEEVEEFLREGILMKSFHHPNVLSLIGIFLPQEGLPLVVLPFMKHG
DLRHFIRCQERNPTVKDLVGFGLQVSRGMEYLANRKFVHRDLAARNCMLDETFHVKVADF
GLARDVFDKEYYSVRRHKNARLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPP
YPDVDPYDITRYLFRGRRLAQPEYCPDPLYSLMLSCWNPQPEERPTFTQLVGDMEVISNS
LCGDHYINLNVTYVNLDRDQPFPPAHPPSEDELEEENSSTEEEENPIA
Download sequence
Identical sequences F6XEZ0
XP_002935671.1.99540 XP_004915612.1.99540 XP_004915613.1.99540 XP_017949161.1.99540 gi|301612350|gb|XP_002935671| ENSXETP00000015919 8364.ENSXETP00000015919 ENSXETP00000015919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]