SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004920182.3.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004920182.3.99540
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 6.41e-53
Family A middle domain of Talin 1 0.00000148
Further Details:      
 
Domain Number 2 Region: 217-353
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.04e-52
Family I/LWEQ domain 0.000000763
Further Details:      
 
Domain Number 3 Region: 124-247
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.01e-48
Family I/LWEQ domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 1308-1437
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.9e-45
Family VBS domain 0.00000157
Further Details:      
 
Domain Number 5 Region: 690-825
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.87e-38
Family VBS domain 0.013
Further Details:      
 
Domain Number 6 Region: 539-671
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.55e-24
Family alpha-catenin/vinculin 0.079
Further Details:      
 
Domain Number 7 Region: 932-1019
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000916
Family I/LWEQ domain 0.0067
Further Details:      
 
Domain Number 8 Region: 1158-1275
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.022
Further Details:      
 
Domain Number 9 Region: 1472-1596
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000738
Family VBS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004920182.3.99540
Sequence length 1727
Comment PREDICTED: talin-1, partial [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MDNSKHEIHSQVDAITAGTASVVNLTAGNPADTDYTAVGCAVTTISSNLTEMSRGVKLLA
ALMEDEGGNGRQLLHAAKNLAGAVSDLLKTAQPASTEPRQVLMQAAGNVGMASGELLKQI
GECDTDSQFQDMLVQLAKAVASAAAALVLKAKNVAERTDDGAQQTQVIAAATQCALSTSQ
LVACTKVVAPTISSPVCQEQLLEAGKQVAKSVEGCVEASEAAVQDPELLKAVGVAASAVT
QALNDLLQHIKKHASGGPPTGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSD
LVGAIKADAERESDLENSRKLLSAAKLLADATARMVEAAKGAAAHPDSEEQQQKLREAAE
GLRMATNAAAQNAIKKKLVHKLEQAAKQAAASATQTIAAAQNAASSNKNPAAQQQLVQSC
KVVADQIPMLVQGVRGSQSQPDSPSAQLSLISASQNFLQPGAKLVAAGKAAVPTVSDPAS
AMQLGQCTKNLASALAELRTAAQKAHEACGPLEIDSALNLVRSLEQDLQEARAAAREGKL
QPLPGETMEKCAQDLGSSTKAVSSSIAQLLGEIVHGNENYTGRAARDVAQALRSLAQASR
GVAANSTDPAVQNAMLECAEDVMDKAGNLIEEAKRAVGKPTDPEGQQRLAQVAKAVSQAL
SRCVNCLPGQRDVDAAIKSIGEASKILLASSFPPGTKNFQEAQGQLNQAAAGLNQSANEL
VQASRGTPQDLAKASGKYSHDFNEFLQAGVEMAGQSQNKEDQAQVVSNLKSISLSSSKLL
LAAKALSADPAAPNLKSQLAAAARAVTDSINQLITVCTQQAPGQKECDNALRELETVREL
LQNPTEPVNDQSYFHCLDSVMENSKVLGESMAGISQNAKTSNLPEFGESVSAASKALCGL
TEAAAQAAYLVGVSDPNSHAGQQGLVDPTQFARANQAIQMACQNLGDPACTQSQVLSAAT
IVAKHTSALCNACRVASTHTSNPVAKRQFVQSAKEVANSTANLVKTIKALDGAFNDDNRV
KCRNATVPLIQAVENLTAFASNPEFASVPAQISPEGLRAMEPIVTAAKLMLESSSGLIQT
ARSLAANPKDPPQWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDQAIELLNQSVRDLD
QASLEAISQQLAPREGISQEALHTQMQTSVQEISNLIEPMAAAARADSSQLGHKVSQMAQ
YFEPLTHAAIGAASKTINHQQQMNLLDQTKTLAESALQMLYTSKEAGGNPKVAAHTQEAL
DEAAQMMHEAVEDLTVTLNEAASAAGAVGGMVDSITQAINKLDEEPAGEPEGSFVDYQTT
MVKTAKAIAVTVQEMVTKSTTNPDELGTLANQLTNEYGQLAQEAKPAAMTAENEEIGSHI
KQRVQELGHNCSLLVTKAGALQCSPNDSYTKKELIESARRVSEKVSHVLAALQAGNRGTQ
ACITAASAVSGIIADLDTTIMFATAGTLNRENAETFADHREGILKTAKALVEDTKVLVQN
ATSSQEKLAQAAQSSVTTITRLAETVKLGAASLGAEDPETQVVLINAVKDVAKALGDLIS
ATKAAAGKSSDDPSVYQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIRQE
LAVFSSPEPPPQTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADML
RSCKEAVYHPEVNADVRMRATRFGKECAIGYLQLLEHVLLVSSPCAD
Download sequence
Identical sequences XP_004920182.3.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]