SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004940194.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004940194.1.86415
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-21
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 2 Region: 228-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000152
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 340-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004940194.1.86415
Sequence length 549
Comment PREDICTED: thrombomodulin [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MRRLLLPLLLAGLGLGLGLVLGLGEPEPPAPSGAQCLEHDCFAVFWTPGPFAAASAACER
HGGHLMTVRSTVAEDAIELLLRKRGGRLWLGLRLPTLCTEPARRLRGFQWVTGDTGTDYD
NWVPSGRRCGQLCVTVSRELSWEERRCDEPADGFLCEYNYPDSCPRLSPSDGASLTYRTP
FGAAGGDFLALPHGSTAFVSPMGLQLLCEAAADSGKMRWGRSEPGAWPCRLDNGGCEGSC
EELDGTPSCACPAGKKLGPDGRSCVSPCAGAPCEQHCVPDGEGFHCMCSEGYELGPDGSS
CQDVDDCVKVPEVCEQVCYNTEGGFECHCHRGYEMVEGHCKPISSCSTGPCDHTCEDVPG
GYQCSCYNGYVVNPKNPTECLQKCEDGRCLAECDASGLYCVCPEGFLLDHLPNGVSLCVD
IDECESNHCEHNCTNTAGSYICHCQPGYMPFDVNHCIPISQEDNEDGYSGDSGPPWPVPS
HIPPKAEHLHPGALVGITMGVLCAALVLLAVGYHLARKRCHPPSSMEYKCGSPREKEMGL
QQVSASQKV
Download sequence
Identical sequences A0A1L1RWW5
ENSGALP00000013601 XP_004940194.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]