SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004988330.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004988330.1.12839
Domain Number 1 Region: 166-365
Classification Level Classification E-value
Superfamily vWA-like 2.09e-52
Family Integrin A (or I) domain 0.00073
Further Details:      
 
Domain Number 2 Region: 27-171
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.00000000126
Family Hedgehog (development protein), N-terminal signaling domain 0.011
Further Details:      
 
Domain Number 3 Region: 568-733
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000143
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004988330.1.12839
Sequence length 736
Comment hypothetical protein PTSG_10281 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MVATVPGALVLAGAALLLHIGQGAHGLAPGESHPSDTTEAEVCGVAVDYIDTGTAQYNDL
VVYETSGNVAFQDETFKRMTDYMAQLLLSLDVVSTETIVVVDGFTPRPEVAVRAPNLLDV
GRALRLRYQADGSAATASRLATLAQACVDAGFDFVSVPNDIGSDNYVHVSVPKMTCGNAA
ADLLFILDGSGSVGSSNFQTMLSFTRTVATFFDVSADTTRIAVMVYASYNYLIFDFNYIL
THTKDELLDAISAINYPYGGTRTGGALDYARTVMFTADRGVRPSSEGIPRVAMVITDGAS
ADDVAAPAQQLRDEGVTLYAIGIAGANENELNEIASPPITSNVVFISTFSEFGTLAAAIS
RANCDRAATVSATQDIMVNETAPGEIRYFQPNLQDLTDDVLIYIEQLSGDTDLYVSGNDS
PGPFNNDASVEGDAPVKAVLVNNTDSSDLVYIGVRSRSDNPNDTVSYRVVVTNSLFVGDA
TYTVSLSARDNVVGKGVFRMPALRDFGLGLERHDFDYTLGGPDSEYFYLTNSGVDILLQR
ELQFGVAYSVIVRGTLEDPVQLTGSVIVTFIFDSTTTTTTTTTTTTTTTTTTTVFAGYRY
EAVADSPATWFEATSACASRGGFLAIVQSHVVSDHVAKLARNATRAVGGSEDTELHTQAW
IETYLPASLAGDGGVANPSETLAFGPWTPTTARSECRFNCPALMFRSRQSRAMAVPKDIQ
CELKRPFICQIPVYLH
Download sequence
Identical sequences F2UQV0
XP_004988330.1.12839 PTSG_10281T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]