SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004989046.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004989046.1.12839
Domain Number 1 Region: 184-408
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000000288
Family NHL repeat 0.025
Further Details:      
 
Domain Number 2 Region: 85-222
Classification Level Classification E-value
Superfamily NHL repeat 0.00000128
Family NHL repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004989046.1.12839
Sequence length 412
Comment hypothetical protein PTSG_09692 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MMMGVAVVVLLVVVVGVLAATASAEVVVEQVDDGTGTLAITTSAHGSEGNGVGSVLFNGE
DVLGMLDNVKATASAMRRAVTRLCNQHGKITSFIAVTSGADAWSGGVLANNNKIYGIPYN
EENVLIIDTISHTVSKILLQGASGDHKWQGGAFAGNGKIYACPNDATSVLVVDTISETAS
TSTITNLDSGRDKWSGGALADNGKIYCVPHDASAVLVIDPASDSADATTLKHKSPAGSSN
LWAGAVRGNDGNIYGVPYSGATILKINPITDEITHIYPGLPTGKNKWRGGVIGRDGLLYC
IPYRDTRMLVSDLDSQRSFFSVADGADSSYKWEGGALGSNGRIYGAPSSASAVLMFDPAT
STADTTSLAIGAPAEPSQSRKWDGLVAAPNGLLYGIPRNSDHVLVIDPRCHF
Download sequence
Identical sequences F2UNS0
XP_004989046.1.12839 PTSG_09692T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]