SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004989777.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004989777.1.12839
Domain Number 1 Region: 83-262
Classification Level Classification E-value
Superfamily NHL repeat 0.00000191
Family NHL repeat 0.027
Further Details:      
 
Weak hits

Sequence:  XP_004989777.1.12839
Domain Number - Region: 230-385
Classification Level Classification E-value
Superfamily NHL repeat 0.0243
Family NHL repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004989777.1.12839
Sequence length 387
Comment hypothetical protein PTSG_08979 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MPSMRNSVLGEVVLEEDDAGAFHINTTDPMSQPVFLNGVNVHEMLSTLMSTVSEQQSAID
RVFGSKVCTLSAQTFGQLGFTTNKWLGGVLATNGLIYAAPSKSPSVLIINPSTNTVDITT
IPGLGTDNGKWAGAVLAHNGLIYMFPSNRDTMLIVDPNTNTIDTSSIDSLGSGNSKWKSG
VAASNGLIFGIPSSATSVLIVDPETNTADITTLSGLLSQDYKWYDGVQAENGLIYCIPAM
ASAVLTINPESLTMDLTTISGLGTGFKWLGGVLSRSGLIYSIPAHSATTLVINPVTNTTN
ELPVVEVTNFPKWVGGVLAPNGNIIGIPYSSSAVIVVNPPTNITDTRIINDLAGSSFKWW
HGVLANDGLIYGIPYNADSVLVIDPGC
Download sequence
Identical sequences F2ULV2
PTSG_08979T0 XP_004989777.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]