SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004990072.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004990072.1.12839
Domain Number 1 Region: 212-470
Classification Level Classification E-value
Superfamily NHL repeat 0.00000000759
Family NHL repeat 0.027
Further Details:      
 
Weak hits

Sequence:  XP_004990072.1.12839
Domain Number - Region: 153-237
Classification Level Classification E-value
Superfamily NHL repeat 0.00154
Family NHL repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004990072.1.12839
Sequence length 477
Comment hypothetical protein PTSG_09648 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MVVLCVLQRVGFGHTVAIPSHPPVLTTAPAEHNGTTVVASATSATTASRTARTQHTSPQH
RSSIHARIPCFAALAAVALLTLAVGSLAGSGRASLTQDANGTVHLRTSDPSQRVLVNDVD
VLGVLRELQSQQGVLDTLKVRMCAGVDALATIGGPFTAPYSDVVAAPNGILYGIPSVGDE
VAWINPRTGQVGTVLIRNINWASSLYWASGVLASNGKIYGTPAKAQFVLIIDPATNTVDV
STIEVPVPPVDPQNAQWAGAVLAPNDKIYAVPRHGTSVLIINTKTNLADVTTIASVSTPL
QTDQWHAAVLAHNGLIYGIPLSASSVLIINPATDTADTTTLANVGSGMKKWLGAVTGQDG
RIYGIPYDSPHVLVIDPSTNTFDTTSVATNFMAGGDKWAGGVLLDDGHILGMPRAAQSVL
LIDPSTNTTDAASLALGMLGSETELQWSAAALAVDGKVYAVPLQIDDVLVIDTFCML
Download sequence
Identical sequences F2ULL1
XP_004990072.1.12839 PTSG_09648T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]