SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004992170.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004992170.1.12839
Domain Number 1 Region: 1947-2135
Classification Level Classification E-value
Superfamily Fibronectin type III 9.69e-22
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 2 Region: 2145-2194,2224-2377
Classification Level Classification E-value
Superfamily Fibronectin type III 4.04e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 2518-2717
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000149
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 2342-2492
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000324
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 5 Region: 2853-3005,3061-3103
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000137
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 6 Region: 2730-2884
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000738
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 7 Region: 45-89
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000538
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number 8 Region: 88-133
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000353
Family TNF receptor-like 0.0018
Further Details:      
 
Domain Number 9 Region: 130-174
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000471
Family TNF receptor-like 0.0018
Further Details:      
 
Domain Number 10 Region: 1702-1756
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000419
Family Type I dockerin domain 0.0046
Further Details:      
 
Domain Number 11 Region: 3-47
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000276
Family TNF receptor-like 0.0036
Further Details:      
 
Weak hits

Sequence:  XP_004992170.1.12839
Domain Number - Region: 1533-1637
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0223
Family Cellulose-binding domain family III 0.02
Further Details:      
 
Domain Number - Region: 1443-1490
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0251
Family Invasin/intimin cell-adhesion fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004992170.1.12839
Sequence length 3371
Comment hypothetical protein PTSG_06772 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MHNSSTCKDCSMCGQGQFVADACTATTNTNCSACTGATFQNMTSHYEMECQACSMCGQGT
FLAMACNRTSDAMCSPCQDGTYQDSSSHLQEQCKQCGRCDPGQRLLSPCTATSNTSCAAC
NSGTWQNATGHLDPTCMMCSKCGLGQKLTTNCTLTANTVCTTCEDGTFQDTDDHTFESCT
ACRTCAAGEEFESSPCTASADRACDPITTCDPRYSRERYAPTPTSDRVCLDFRKAAVTVM
VQVDTLETEIDATRAAIEAAIQDGSNGPLARELRKLDDAAYNNTEVTYLPQVSRFDVPSE
GRQFVYLDLQFAASSTQFDIQKLDLLDVLGAFLLNATEDADATATFMERSTVTTTTTNTT
TNATTTTHSTTALFRVDVDAALTITTDALNAMAAAIDAANTTSLQRTAGPTANGEPELGF
CGGLCLQCTECSLDQYLTNVCEGTSDAQCNALPTEFETAPPVNVVGVNTNHILPAAASQQ
QDQAMDASMRVNRSFVFTNIAPGESTWVAVSGEPEDGAQMVTRPLAPAAQVDCAPVLDNV
YSTYPTAQVVLAALDASGHSRVARKHDEDAEVTATCTMPTDGPAVCNARTTFADAWFSSA
GPRLVDVTYKYTTPRADGEGYETSPDMACGQLTLGPAQQEVLGVSSNIAAVVTPTNSVYE
NDTVDVAVIARHDWAVHSFGVSLRCGNCRIEMSEANTAAWSISSTVTTDEESGEQMLVVA
GIARDLTDEPRFSEQRSFSLFTATVHAVPAAEDSMLVLRGNIDSFLQVRNRRPIVDTRTR
DVKLPVLANDGSGVDATSWTQPILAIEPVRAHVFVGGGLGVVFDTASITDATTDLPVSLV
GVWPRGDALRNVANPETDLVDCQLVDMSAVLDAVSCSAVSLAPFTPQDMPTTDPVELQLS
VGGMAAFGTANIMLMRPASKLTIAPPGDISSDTTVVLRPIREVNATSNACADVQFMSSWL
QVSASFPNGVTLDVTGIAAMTTSNSNVATIDTATSVVSGVGAGSASFVCTNNHDCADTTI
SVMSDVPAVALGVRAYAVGGATFTATINDAGNLWVSAAVSVSSSNLLRFTSSANAARLHV
AAVVMEQVTDNRQQLALAPAAVAFASDNTDVATVAQSNDDPATVTTTATSGLAAITAQWP
KATCARKTFEAAVNVTTTDATVVSIAVSPTSVDLVVPFANAGAAEAVTGLPSSAAFTVTR
TLSDGSVETVTSASFTSADENCGDFTGMLALETDAVASECTYTTVDGDLMASVTVNKYAL
DAVRMTVTARGVEGSATHTSGAAAAEQFEVPPIGAGATAWPALTASCVAVFNTTKQDMAV
TVQLRQVATMAQAVFASSFTAANDDQQDQEDAALALQPADASLQITTSIAGNATLSATFG
GLTATTAVLFAAGDDASLPLSVTGASVADVVANANGTFPLLGRVNATFTLDIAAEVTGEP
LSPGQVRLDDGSLAIRSLVTFTSSNTDALSVDAHGIITLHDGSATEVTIGIAVNGTVQAT
VTCLPSLLPAEGAGSFGPHGVSAASFSRVRVPLHVEAENLRAAVLSLTYDPALLTLATVE
LGSDVQFAFLDFNVRTPGELSVFVVIPGNAITSDDLELGVAVFTTRNLTTTSPQLSLGGS
VVEVDANGNPSLVELDATTSSLSVETTPMMMTRRRRSSLTSDGAADLELDAAAMVANTLA
RRRRSGPRGTLTTVLANHPTFDMNGDGVLDVLDVLMLSDVYSGRLTENDLAEGADADTNS
DGIVSFDDVSFLLSLAAGRLVALRRVAVTPVQAADSDCMLSFNVSVLLTNITLSTPKGDD
TRLYLDVAGVASSSDFDATFAAASTAPGPNFKFVRIPYARTNRTEDTGAYFLQASTPLAS
SDQLGVSVLQVDGSGAYNFHTRQDMIVNNTLDASFDVDGTNVSLFLPFGYAPIRAFTNTM
DTPTCLAQRRPVITDFTRPDPDAMNVVDGYLLLLDWTAPPTPPNAITRYFVQYRDLNVTG
APVIEKSVDGNTLHLDLTDQILPYHTYEVQVQAEFGNRRSVISTPATAQTHQDTPNMPPQ
LDAVAVINATAVNVTWTPLDETDLNGVVQYLVLVQRLDDEPNADPNAPSQFVRTVNHPVS
STMFTGLEESVKYNVTLQARTNVDTGFAISATEFYLPAIVFETGDVPPDPPELVSIVPSD
TSFTITWEAPPPETHNSDLVAYLVRVRRAASTTYADNTTITDADFGGADDWHVFRYSAQT
FTKEFTTLDFVNLLHPAIVYEFQTQTEGTSSLFSPWSETYTVRLLESAPTGNVTNTDVTT
TSSSLMVEWQLPEPLERKGLITNFTIVYSRQDDDPRVATDSLDNCPASVCNSFVPANGDV
VYTWPLVGLEAYVTYTVEVRAWTSAGIGPAATFVIRTDEAIPSAPVVFGDVSVTPRTVDI
DFDPLPVPDRNGIAAYTATLTISTDPFYTQRIDSALAASLPVVTEFENQPNSTLTFQATG
LQPFMEYTLEVVPHTSVGDGEANTITVLTEEETPTAPAITNVQVLADDTAQEKRVRVSVN
IRPLNRRNGVLQNLTIEYGNDAFGDLATLQTPLTSAERATTTVSRVIDGLRAGVLYSFTA
TVANRAPVSPESPTSPSFSKTTDEYIPTGPVLNLVAAEETDETDASKRVLLTWNPPTLAT
RNGIITEYRVVVRVTPNQQAQAQVHSDLTYSLAELGSNNQGDGLSTRFTSLGAYDKYTFS
VTPLTAIGEGTDTTTVSTPDNNGILSPALPGASVGQLTTTKGTTTLDVSWNALAVSDWND
ASLQYRVILTQLADDHSDTPAEHVVATQETSTTSVSFSGLQEYVQYKVDVYPINSVFVGM
EQAGGFDASALLTTNTVRTEAAPPAATPVITDRSNDAHSITVQWGRIAMHDFNGPPRHYV
VSYKGLAVDYVENGGQSATSPELDATDVIVPYDASEENPSVTLTDLEPNRMYEIKVAPEN
TEFAPGPFSATESVQTWSFRPAELPTVQFHDDRPNGESKQTTLRITWPIINTRFGPVRQV
QVIVEPEDSRHFNTMYNCTSASGEDECAFGGWETSENARVNKQTPRAYIAVQRLYTGDDA
TQTSGSLVVGDELNYGGFFNGPLRAGTTYTVRLRAFTQSGDGTEMFDTVGTISEPVYDEK
GRLISSPQASTTTSSSSGGSPVGIIAGGASATALVLIVLVVVILQACRSGTTKTARLPAP
TNDGLMMTANNPTFSQPGQHVHDHHVYAELSTSEEEAAAARMQQLRFRWNPAVYDIGPVD
GAGAATNGDTLGTRLQGMASTRTHAWEPHTFDVYGGHGTTAAGNDSPVRDEEPAESAAEK
TDGAYDTVIGVGVGGLPESQEEDDDTAGEEREESRKREEGQQLAQLRLKQKDDESPYEVI
EGFADVDMSSA
Download sequence
Identical sequences F2UER7
XP_004992170.1.12839 PTSG_06772T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]