SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004992682.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004992682.1.12839
Domain Number 1 Region: 1257-1315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000903
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 1053-1117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000143
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Weak hits

Sequence:  XP_004992682.1.12839
Domain Number - Region: 1158-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1206-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1327-1361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0817
Family Complement control module/SCR domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004992682.1.12839
Sequence length 1793
Comment hypothetical protein PTSG_07263 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MAGQHRMLLLLALVCAACLASTQAQSDCAGLGENDCQPPCVFSNSTGQCHKAGCAYTPFV
DCDAPCTPNPNTLACHVSSDTGGACAEYDFENCPARCLKLSVDNSCSEITCDTYDIEEAC
LNDNDDLDCTYDADISRCRGTNETVQCTEYSPDNCPADRCDAFDGTFCVEKGTYPSCAFY
SMEDNCNSKSWCTWSPLYGACGTKAGEFECGQLLDFLSCVDQDQCCFDSGLCVDLQDGQS
CTRTRDACSSFSLGDCPSSYCLPNEDAGECEDPPCLAIRTNRTCSTRNECIFLPEGCRAD
GEPPCDQYTSQGTCPWKCTWDFGSDSCMARACTDVFDEGTCLALGGCAYDFGRCHDEGTA
VSSSTQIATTQSFDIDCSQFANMTTCRYPCFWSETDALCRNRTCTQIFDETACEANAACE
WTVNDFFPCTPVDTGLACTEYSRDLCPITRCTLGADDGSGPACRDKTCAELNANECTNST
ALACQYDESYRICYPEGEELPCGIFNENDCPARCNYSVGAQSCYQPGTVLPCSRFNKQQF
CEQQDECTFYSIVGLCVNDTQPDYQCNLIYNDQFCRDSPICTYGADGCQKCTANNTADCI
QPCPDVSLPDCSQLTQASCFSEPSCVYNFELVQCTRAVCTDVLSYDKCLCESLTNCTYDG
KRCKYFDDGRPCEEKTTALECGGADPRCFSDYNDETGIFECRNATCADQYGQTACEGFEG
AECEWLSYYGLCNDAGAKVPCTRIYEKYACGNSTECTYYSDINLCYYKDEEVPCEKYRTA
TSCPSDRCSFYPTIPLCAPQGQQVPCSAYDSELACLSNDACRYVPGAYACVAADEPSPCT
RISNAVACGDTVGCKHDGAKCVACKDDEACNGTSGLQPCEEAEVCNAQYCFPTDNSCISL
SCDRIFSRFYCSALDGCRYDPYTYRCVEESSITDCEDLPNESICTLANTRDNRTSACVWD
ADYGVCFTEGNPLPCKAFKNETACNLLPYCEFNVVCQDYVTTTTTTTTTTTAYINACDRR
PCATNVECTPLEESNTYECGDCPLGYEGDGRTCTLVTCPSQLSLGVGAEYAFADKCFFTN
YGDDCNARCDSNYEQIGDGVFICSANGTWIGNLTCNEIDRCMDDPPPCDPLTTCTKVASN
SFTCTSCPTGYRNVAFRPKTKCMNINECEEQHPCHPRRNCTDTMGSFECGKCEPGWREVN
DRECEDIRECTELEPCYPGVKCTETDGSFACGKCPTGYTGTGVGPDGCEIVRCPLDDVPS
YENADVDCAGNVFDSTCTATCKEGYSNSEATIQCKADGQWTTPSLTCSKLPCANQPDASL
LPIGVVNPQCAGRHQCTLECKAGYRGEGNPSLTCPTTAWVGDTENPFTCVPCDAGSTYQN
TPGSTTCLPVSPPCGEGEYESAAPTTSTNRRCRAVKDTCREDFEYSTQDPTPTSDRVCST
CTACPVGQYRSGGCDGLFDAQCAACSTCGGFSYELLACTQLADTTCATCPFGTFYSRASS
RCQDQPYCFVGQIEAVSPTPLRKRNCTRVRIDTPPPPGTVARVYTITLTGIDGTLPLDVG
VLLVESVRRVFVWADVDVRVGILSVNVGTNARRRRSLESEVVVRVEASEDDASAVDGTDV
SAQSLRAAISAVASDTQGDSSVSRALREAAAALLELEPESVGASNVQPSSTAGTTNQQST
TNSAATTDPQSSQSGGTDNTTLYIIIGSVGGVVLLVVVIAVVVTCRTSGRSKGASISGAG
GAVASPYQENNYSNVHELMAMKTLETTARAPVATRATRQGSFYSSITQAASEI
Download sequence
Identical sequences F2UEI8
XP_004992682.1.12839 PTSG_07263T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]