SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004992716.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004992716.1.12839
Domain Number 1 Region: 225-345
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000211
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004992716.1.12839
Sequence length 374
Comment hypothetical protein PTSG_05823 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MAGRPQDARLKKLLTAFNVLDHWPKLEQRGVRNVFALAKLSDQELVGLLHLDQSQLRKMR
AVLTKLEAARAQHRGEQQQKRASANPQRKSQQSEQQQQQPQQHRGPAGVQRRSHAGTAAA
AASSSSSSSNRNSRVLNLAPAPGFSGPIDGALHRVPSRTQRGPPSRGSGGLPAGTRQSRK
SYDMRSPPKKASSSSSVKTRSRPSKAAQYTAQPLRRSLWDFDFDVDVLPTVVCECWATKC
GGKVKSWQKRYFVLRNDGSLTYSKEGALSDHKGVIDVRDATVINGPGSCNWLKEDGAPPA
AEPSKRVEIVTPVRTFKLFCDTQADATMLHSKLQEVWKYCKRAKKRAPLTERDIAGGEGY
QRMLAEVAHVMTAQ
Download sequence
Identical sequences F2UCW4
PTSG_05823T0 XP_004992716.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]