SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004992826.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004992826.1.12839
Domain Number 1 Region: 145-353
Classification Level Classification E-value
Superfamily YWTD domain 0.000000314
Family YWTD domain 0.024
Further Details:      
 
Weak hits

Sequence:  XP_004992826.1.12839
Domain Number - Region: 326-425
Classification Level Classification E-value
Superfamily NHL repeat 0.00204
Family NHL repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004992826.1.12839
Sequence length 441
Comment hypothetical protein PTSG_05933 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MASVLRAAPVLVPVLVLVLVAAACNRCNLQQHACPCMCAAEVVFAEDDAGALHINTSDPM
SQPVLVNGVNMGAVFDAVAAQQSMLQAYQSVMDTQQSRISMQQSRIAVQQDRIAALEAEV
CTPSTSVFGQLSGASNKWVGGALAGNGLIYAAPFNADSVLILNPTTNTADVTSIAGFTSG
GGKWAGAVLAENGLIYMFAASATSMLVVDPETNNVDVTSIHSLPSGALKWASGVVADNGL
IFAIPYAFPSVLIVDPATNITTTIALDGLSGSGTEWYGGVQAANGLIYCFPSAATFVLII
DPIALTADTTSIQGLEAGAYKWLGGVLARNGLVYGIPARAGTVLVIDPTTNSIDMIRIAN
STITSRWAGGALAANGNIVCIPYSSTPALIFNPATNATTMVAVPDVGEGPVGWWDGVLAP
NGRIYGLPLFPEVVLAIDPGC
Download sequence
Identical sequences F2UD74
XP_004992826.1.12839 PTSG_05933T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]