SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004997310.1.12839 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004997310.1.12839
Domain Number 1 Region: 182-527
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-95
Family beta-N-acetylhexosaminidase catalytic domain 0.00000487
Further Details:      
 
Domain Number 2 Region: 34-180
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.000000000000698
Family beta-N-acetylhexosaminidase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004997310.1.12839
Sequence length 573
Comment hypothetical protein PTSG_01337 [Salpingoeca rosetta]; AA=GCF_000188695.1; RF=representative genome; TAX=946362; STAX=946362; NAME=Salpingoeca rosetta; strain=ATCC 50818; AL=Scaffold; RT=Major
Sequence
MAMVSVLVVAACVVVLSVVGVRGYQDDGTRAARPWPPVKTWNKSASGSVATLNPCTFVFT
DKSAQPSGVERAIDLYKHVIFGNAGPCTSEDKARMLAGGDVLTGIEITAQHPIPGVAKNH
EDYALEIPAGGTAMLTATSYEGVLRGLETFSQLVLHSALQPNDARTWHVADVPLQIEDAP
TFGHRGLLIDVARTFLPVPVIKTIIDGMMYSKLNILHVHLTDSQAFPLQLHQNPEITFHG
AQSADMVYSQDDFRELIQYATDRGVRVYPEIDSPGHTRAMGLAPTLHDIVSCANVSNWGK
CCNEPPCGQLNIASQHMMQVLRNVTSEVAALFSDEYFHLGYDEINFNCWKQDASVQRYLK
EHNVTINELLLTFFKNQRDMLHDVAPAKKRLYWEEASKQNPPLPLDKSTIVQVWGPPATL
HEVLNDTDSDVIVSTSTDFYLDCGLGNMFGQASWCDPYKTWWHMYSHDILANVSKSDASR
ILGGESCSWGELAGPDNSLVRIFPRASAYGARLWQYANTVSQREANLRIADHAERLSRRG
IPVSGTTLQYCRLYPDMCYGFLDNKQHDGNIHR
Download sequence
Identical sequences F2U021
XP_004997310.1.12839 PTSG_01337T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]