SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004999304.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004999304.1.53824
Domain Number - Region: 123-159
Classification Level Classification E-value
Superfamily SET domain 0.0373
Family RuBisCo LSMT catalytic domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004999304.1.53824
Sequence length 308
Comment PREDICTED: palmitoyltransferase ZDHHC7 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MQPSGHRLRDVEHHPLLTENDSYDSASSSASEADTADRVWFIRDGCGMVCAVITWLLVVY
ADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEHMES
LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEQNQRFFVLFTM
YIALSSVHALILCGLQFISCVRGQWTECSGFSPPITVVLLIFLCLEGLLFFTFTAVMFGT
QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQARPR
KGGPEFSV
Download sequence
Identical sequences H0V9E7
ENSCPOP00000006435 XP_003460969.1.53824 XP_004999304.1.53824 XP_004999305.1.53824 XP_013001671.1.53824 ENSCPOP00000006435 10141.ENSCPOP00000006435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]