SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005015237.1.99704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005015237.1.99704
Domain Number 1 Region: 37-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.41e-56
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 279-321
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000034
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005015237.1.99704
Sequence length 322
Comment PREDICTED: ankyrin repeat and SOCS box protein 11 isoform X1 [Anas platyrhynchos]; AA=GCF_000355885.1; RF=representative genome; TAX=8839; STAX=8839; NAME=Anas platyrhynchos; breed=Pekin duck; AL=Scaffold; RT=Major
Sequence
MEGSSILHAFTNIYFAIFALFCFKLLIKISLALLTHFYIVKGNRKEAARIAEEIYGIVPG
SWADRSPLHDAAFQGRLLSLKTLIAQGFNVNLVTTDRVSALHEACLGGHVACAKLLLENG
AQVNAATIDGITPLFNACCSGSVACVNMLLEFGAKPQLGSHLASPIHEAVKRGHRECMEV
LLAHKVDIDQEDLQHGTPLYVACTYQRTDCVKKLLELGANVNAGKRLDSPLHAAARKSSV
EIVVLLADYGANLKGRNADFKCALDLAVPNSKIEQALLLREGPASLGQLCRLCIRKHLGR
SCLYAVPKLHLPEPLENFLLYR
Download sequence
Identical sequences R0K4C9
XP_005015237.1.99704 ENSAPLP00000013357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]